DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33511 and CG31436

DIOPT Version :9

Sequence 1:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_733096.1 Gene:CG31436 / 318734 FlyBaseID:FBgn0051436 Length:420 Species:Drosophila melanogaster


Alignment Length:404 Identity:95/404 - (23%)
Similarity:181/404 - (44%) Gaps:66/404 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ILINSQVDAGSK--DL----MGYMGEYY-KLHLEAEVKGDKKK--YFLNYFIKSLPRKNEPQREE 81
            :|..::::|..|  ||    ....|::| .:...|.||...:|  :..:..||::|.....:::.
  Fly    29 VLEGNELEAAVKVIDLTFSPASAKGDHYASIMFRARVKYTNRKGEFQKSLIIKTMPEAEGHKKDM 93

  Fly    82 CERKGVFQKESALYSQILPKIQKYATK-----KLYPKCYY---SRNDILVLEDLTQ-DYRHLRAN 137
            .....:|:.|..||:::||:.::...:     :||..|.|   ..:.:|:.|||.: .|..||..
  Fly    94 LGGSPIFETEMGLYTKVLPEFERILRQVGDDTQLYVNCIYHSLEPHQVLIFEDLAEMGYIVLRDR 158

  Fly   138 EYYTLDHYKIVLEHLSELHAASIAWEEKENVKIYESYKNVLIELHLDSNNSWYITGLKAIVFLAA 202
            : .|||..:.:...|::.||.|:. .:.|..:..|||.:.|.|:....|:.:..||::..|.|..
  Fly   159 D-ATLDEIRRIYFKLAKWHAVSLK-VQNEQPEFLESYTHGLFEMPHVLNDPFMRTGMEFFVELLG 221

  Fly   203 R-------NPHFQTMKAQNFIQDKLYNLLTKAEELVAPSKTIRN--------VLCHRDTWDHNIV 252
            :       .|:|:::| .:|:           |.||...|.||.        ||||.|....||:
  Fly   222 KEPELNKYKPYFESIK-DDFL-----------ERLVEEWKDIRKSQKKDEYWVLCHGDLHLRNIM 274

  Fly   253 YYFNKESSVLPNACCIVDFQLTQYCSPTLDVLFLLYIVASAEVRRAIYDECLEHYYKNLQHHLDR 317
              |..:.:|....|.::|||::.....|.|:|:.:|::...|.|...:|:.:.:|...||..|.:
  Fly   275 --FKHKDTVSLEDCMLLDFQISNLFPLTFDLLYSIYMLLEPEHRWNNWDDLINYYISVLQDVLKK 337

  Fly   318 LGLDKNLITENNFRKECQRTRLAAL--------VIWALTEPQTKMSPSISNRLRSEEPEKFDYYL 374
            :|....:.:::...|...:.:....        ::|||.:    .|....:.|::||..:     
  Fly   338 IGYKGVMPSQSGLWKRLHQHKYYEFFLISTFLPLMWALRD----KSVDFGDLLQNEEKRR----- 393

  Fly   375 NCDRSELLLRVIEI 388
            .|..|:..::.:.|
  Fly   394 KCSFSKGYIKEVTI 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 78/304 (26%)
CG31436NP_733096.1 EcKinase 52..340 CDD:281023 78/303 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459888
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.