DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33511 and CG31380

DIOPT Version :9

Sequence 1:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_733121.1 Gene:CG31380 / 318701 FlyBaseID:FBgn0051380 Length:405 Species:Drosophila melanogaster


Alignment Length:393 Identity:92/393 - (23%)
Similarity:166/393 - (42%) Gaps:75/393 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GEYY-----KLHLEAEVKGDKKKYFLNYFIKSLPRKNEPQREECERK------GVFQKESALYSQ 97
            ||.|     ::||          .:.:...:.|..|...:.|:.|.|      .::.:|..:|.|
  Fly    37 GENYGAILTRIHL----------VYSSIVEEHLIAKTVLEYEDAETKMKKAPYDIYNRELEIYEQ 91

  Fly    98 ILPKIQKYATKKLYPKCYY--SRNDILVLEDLTQDYR-HLRANEYYTLD--HYKIVLEHLSELHA 157
            :|||:|:.|.::|.||..:  .:...|::|||:  |: .:.|.....||  |..:||..|:::.|
  Fly    92 VLPKLQELAGEQLCPKILHIDRQRGALIMEDLS--YKGFVMAPRLQRLDEQHVSLVLRKLAKMQA 154

  Fly   158 ASIAWEEK--ENVKIYESYKNVLIELHLDSNNSWYITGLKAIVFLAARNPHFQTMKAQNFIQDKL 220
            ||...|..  ||......|.......:.:|.:::::..||:               ..|:::.:.
  Fly   155 ASAVLENNLLENNFSLTEYDKGFFNRYTESFSAYFLGCLKS---------------CANYLKTQA 204

  Fly   221 -YNLLTKAEELVAP------------SKTIRNVLCHRDTWDHNIVYYFNKESSVLPNACCIVDFQ 272
             |....|..:.:||            .:|..|||.|.|.|.:|:::   |..:.:|:...::|||
  Fly   205 GYEHHAKLLDELAPYYMGLGLRCFKQEQTHINVLTHGDLWTNNMMF---KYEAGVPSDVLLIDFQ 266

  Fly   273 LTQYCSPTLDVLFLLYIVASAEVRRAIYDECLEHYYKNLQHHLDRLGL-DKNLITENNFRKECQR 336
            ...:.|||||:..||...|..:||..:..:....|:......|.|||. .:.|.:...|..|.::
  Fly   267 YAFWGSPTLDIHHLLNTSAVEQVRSELQMKMRGVYHDVFVGELQRLGFKGQRLPSRKQFHLESEQ 331

  Fly   337 TRLAALVIWALTEP---QTKMSPSISNRLRSEEPEKFDYYLNCDRSELLLRVIEIQPGYEETIMT 398
            .|..|:....|..|   .|..:.:....|.|::|...|          :.|.:.:.||.:::|..
  Fly   332 KRFYAVHCGLLLLPVLLNTDETDADFAALLSDQPRGMD----------MKRRLYLNPGIQDSIKQ 386

  Fly   399 PIR 401
            .::
  Fly   387 MVK 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 74/305 (24%)
CG31380NP_733121.1 EcKinase 36..314 CDD:281023 75/306 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459509
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.