DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33511 and CG31288

DIOPT Version :9

Sequence 1:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_733094.1 Gene:CG31288 / 318664 FlyBaseID:FBgn0051288 Length:428 Species:Drosophila melanogaster


Alignment Length:375 Identity:91/375 - (24%)
Similarity:156/375 - (41%) Gaps:91/375 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DLLSSEECHLIA---------QRTLSVVKKDNVILINSQVDAGSKDLMGYMGEYYKLHLEAEVKG 57
            |:::..| |||.         :..|:..:.|:|.::...|.|.......:.....:::::.|:|.
  Fly     6 DIVNPNE-HLIIPDWINEKYFESVLAKDEPDHVKVLKFTVVAAIPPGENFTSTMLRVYIKLEMKD 69

  Fly    58 DKKKYFLNYFIKSLPRKNEPQREECERKGVFQKESALYSQILPKIQKYATKKLY----------P 112
            ...|.....|...||  .|....:....|:|.||:.:|...||     |.:.||          |
  Fly    70 GSVKTKTYIFKTMLP--EERGGSDINEFGLFPKEAMMYKTYLP-----AFEALYKDVGWDIQLAP 127

  Fly   113 KCYYS---RNDI-LVLEDL-TQDYRHLRANEYYTLDHYKIVLEHLSELHAASIAWEE-------- 164
            ||.::   ..|| .:.||| .:.::::...:...::|....|:.|:|.||||..:||        
  Fly   128 KCLHTEEREGDIHFIFEDLCVKRFKNMDRTKGLDMEHMTKCLQKLAEYHAASAVYEELHGPYPSE 192

  Fly   165 ------KENVKIY---------ESYKNVLIELHLDSNNSWYITGLK-AIVFLAARNPHFQTMKAQ 213
                  |::||.:         ::||..::        ||   ||| |..::.|    |.|:|  
  Fly   193 FSEGFVKKDVKKFHVDGFQLKEKAYKKAML--------SW---GLKDADKYIKA----FPTVK-- 240

  Fly   214 NFIQDKLYNLLTKAEELVAPSKTIRNVLCHRDTWDHNIVYYFNKESSVLPNA----CCIVDFQLT 274
            .:....|..|....:|.        :||.|.|.|..|::      ||.||:.    ..::|||:.
  Fly   241 QYWAQCLSTLELNPDEF--------HVLNHGDFWSSNLM------SSYLPDGTLEKLILIDFQIV 291

  Fly   275 QYCSPTLDVLFLLYIVASAEVRRAIYDECLEHYYKNLQHHLDRLGLDKNL 324
            .:.||.:|:||.|.:..:.::|...:|..:..|::.|...|..|.|.|.|
  Fly   292 MWGSPAMDLLFFLTLSPTNDLRIKEFDHFVRIYWERLVECLKVLKLKKPL 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 77/320 (24%)
CG31288NP_733094.1 EcKinase 50..331 CDD:281023 76/318 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459664
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.