DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33511 and CG2004

DIOPT Version :9

Sequence 1:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001259353.1 Gene:CG2004 / 31809 FlyBaseID:FBgn0030060 Length:425 Species:Drosophila melanogaster


Alignment Length:325 Identity:84/325 - (25%)
Similarity:149/325 - (45%) Gaps:48/325 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 YMGEYYKLHL----EAEVKGDKKKYFLNYFIKSLPRKNEPQREECERKGV-FQKESALYSQILPK 101
            |:...:::.:    |||...|:|:..::..:|::|  :...|....|..: |:.|...|:::||.
  Fly    46 YLSRVFRITIYGVKEAEEGQDEKQLEISVIVKAMP--DNLHRRRLFRSVIFFRNEINFYTKVLPA 108

  Fly   102 IQKY------ATKK---LYPKCYYSR----NDILVLEDL-TQDYRHLRANEYYTLDHYKIVLEHL 152
            |:.:      |.||   .||:|..|.    ||.:.|||: .:.||.....:|.:|:...:.:..|
  Fly   109 IEAFQKSRQPAPKKPFVEYPRCLASLCDGVNDFIALEDVGPRGYRAPVRQDYISLEDALLTMRTL 173

  Fly   153 SELHAASIAWEEKENVKIYESYKNVLIELHL-DSNNSWYITGLKAIVFLAAR--------NPHFQ 208
            ...|..::|:...:: |.:|.....|.|.:. :....|| ||...:....|.        |..::
  Fly   174 GRFHGVALAFNALDS-KNFEKAAGSLEETYYGEHTREWY-TGFLLLAENVATDAVKQIYPNSKYE 236

  Fly   209 TMKAQNFIQ----DKLYNLLTKAEELVAPSKTIRNVLCHRDTWDHNIVYYFNKESSVLPNACCIV 269
            |: |.||:|    |.|.||::...:|        :|..|.|.|..|.:..:|:...  .....|:
  Fly   237 TV-ATNFLQPPLFDDLINLVSTRSKL--------SVFGHGDCWTPNFLTKYNERGQ--SEEIIII 290

  Fly   270 DFQLTQYCSPTLDVLFLLYIVASAEVRRAIYDECLEHYYKNLQHHLDRLGLD-KNLITENNFRKE 333
            ||||.:..|..||:.|.:|...|.|:|...|||.|..|.::.|..:..||.: :::|:..:.::|
  Fly   291 DFQLARCSSLALDLSFFIYSCTSQELREQHYDELLRAYLESAQDLIQDLGGNAESIISWESLQEE 355

  Fly   334  333
              Fly   356  355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 80/308 (26%)
CG2004NP_001259353.1 EcKinase 42..340 CDD:281023 80/308 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.