DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33511 and CG32195

DIOPT Version :9

Sequence 1:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001262006.1 Gene:CG32195 / 317907 FlyBaseID:FBgn0052195 Length:401 Species:Drosophila melanogaster


Alignment Length:352 Identity:86/352 - (24%)
Similarity:137/352 - (38%) Gaps:83/352 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 YMGEYYKLHLEAEVKGDKKKYFLNYFIKSLPRKNEPQREECERKG-VFQK--------------- 90
            |..||::..| |...|.:.....|:.||::.:|.|.......|.. ||::               
  Fly     6 YSAEYFERAL-ARAYGCEMLRVENFHIKAVSQKGENFCSVIYRVALVFRRSPDGALESGKYILKD 69

  Fly    91 -----------ESALYSQILPKIQ--------KYATKKLYPKCYY----SRNDILVLEDL-TQDY 131
                       |..::..:||.:|        :....||...|..    :..::.:|||| ...|
  Fly    70 LLPAAAALGTNEKDMFEVLLPAMQAILEEAPKEIGEHKLSADCLLVEISAGKELYILEDLGALGY 134

  Fly   132 RHLRANEYYTLDHYKIVLEHLSELHAAS-IAWEEKENVKIYESYKNVLIELHLDSNNSWYITGL- 194
            ......:...|:..||.:..|::.|.|| :.:|:|.             ||....:.|.|..|| 
  Fly   135 ESFDRRQGLNLEEAKICVRKLAQFHGASKVLYEKKP-------------ELIQRLSPSHYANGLN 186

  Fly   195 ----KAIVF---------LAARNPHF-QTMKAQNFIQDKLYNLLTKAEELVAPSKTIRNVLCHRD 245
                :|:|.         .|...|.. :.||||   ..|.|.  .:..::|.|:|:..|.:.|.|
  Fly   187 DRFAQALVLEGAEYAAEAFAEELPEISKKMKAQ---IPKAYT--KRMRDVVDPNKSSLNAVIHGD 246

  Fly   246 TWDHNIVYYF-NKESSVLPNACCIVDFQLTQYCSPTLDVLFLLYIVASAEVRRAIYDECLEHYYK 309
            .|.:||::.| ||:::       :||||...:.||.:|:.||.|.....|:.....||.|.:|:.
  Fly   247 PWLNNIMFDFVNKKAT-------LVDFQNCYWGSPAIDLYFLFYTSLKPELLLNNQDELLNYYFD 304

  Fly   310 NLQHHLDRLGLDKNLITENNFRKECQR 336
            ||...|...|....|.|....:.|.:|
  Fly   305 NLLETLRHCGYKDTLPTFGQLKDEMKR 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 81/333 (24%)
CG32195NP_001262006.1 EcKinase 37..315 CDD:281023 72/302 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459521
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.