DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33511 and CG13360

DIOPT Version :9

Sequence 1:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_569859.1 Gene:CG13360 / 31025 FlyBaseID:FBgn0025620 Length:421 Species:Drosophila melanogaster


Alignment Length:331 Identity:76/331 - (22%)
Similarity:140/331 - (42%) Gaps:66/331 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 YMGE-YYKLHLE---AEVKGDKKKYFLN--------------YFIKSLPRKNEPQREE------- 81
            |:.| ::|..||   .:::.|.||...:              |..|:|.|.::.|.:|       
  Fly    17 YLNEDFFKAALEDGLRDMRVDIKKIIFSESSGGGGENYCSKIYRAKALYRSSKRQLDEELALIVK 81

  Fly    82 ----------CERKGVFQKESALYSQILPKIQKYA--TKKLYPKCYYSRND---ILVLEDLTQDY 131
                      .|...|:.:|...|..:|.|::...  ..|...||.|:..:   .:|.:|||| |
  Fly    82 SIAITPATQFLEELAVYLREKIFYFDVLGKLEVLIGDGSKFGAKCLYTTREPIQTIVFDDLTQ-Y 145

  Fly   132 RHLRANEYYTL--DHYKIVLEHLSELHAASIAWEEKENVKIYESYKNVLIELHLDSNNSWYITGL 194
            .:..|:....|  :|..::|:.|.:.||:|:...||| ..:.|.:...:::.:....|..:|..:
  Fly   146 GYKLASRQSGLNEEHCVVILKKLGKFHASSMVLAEKE-PSVREHFTTGMLDENYIRTNERFINFM 209

  Fly   195 ----KAIVFLAARNPHFQTMKAQNFIQDKLY--------NLLTKAEELVAPSKTIRNVLCHRDTW 247
                :.:..:.::.|.::      .:.:||:        ||:|....|  |.:.  .||.|.|.|
  Fly   210 TLQCRTLANVVSKWPGYE------LLAEKLHRHCDNIKENLVTTGRPL--PGEI--TVLNHGDLW 264

  Fly   248 DHNIVYYFNKESSVLPNACCIVDFQLTQYCSPTLDVLFLLYIVASAEVRRAIYDECLEHYYKNLQ 312
            .:|.:|.::.|....|.....||||.:.:.||..|:.|.|......:|.....:..::.||.:|:
  Fly   265 VNNFMYKYDDEQPTKPIDAIFVDFQNSFFGSPGCDINFFLNSSVQLDVLIHRREFLIQTYYASLR 329

  Fly   313 HHLDRL 318
            ..|:|:
  Fly   330 DSLERM 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 76/331 (23%)
CG13360NP_569859.1 EcKinase 50..335 CDD:281023 67/296 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459275
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.