DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33511 and T16G1.6

DIOPT Version :9

Sequence 1:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_506234.2 Gene:T16G1.6 / 188554 WormBaseID:WBGene00011800 Length:431 Species:Caenorhabditis elegans


Alignment Length:432 Identity:88/432 - (20%)
Similarity:175/432 - (40%) Gaps:124/432 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KDLMGYMGEYYKLHLEAEVKGDKKKY--------FLNYFI----------KSLPRK--------- 74
            ||:...:||  :::.|:.: |:..||        |::..:          ..||:|         
 Worm    23 KDVQEAIGE--QMNTESRL-GENTKYTVVGDGNGFMSRVVLVEPEWTITENHLPKKFILKICSSL 84

  Fly    75 ----------------NEPQRE-----ECERKGVFQKESALYSQILPKIQKYATKKLYPKCYYSR 118
                            ||.:.|     |.|.:.:..:|...|  :|.:......:.|..|.::|:
 Worm    85 HVHGIVDKMKESNQSINENEEELWAMFENEAQHLHNREVNFY--VLAEKWNKPEELLNAKIFFSK 147

  Fly   119 N-----------DILVLEDLTQDYRHLRANEYYTLDHYKI--VLEHLSELHAAS--IAWEEKENV 168
            .           .:..::|:|  .|||    |..|..|::  ||:.:::|.|.|  ::.||.:::
 Worm   148 KFDSENKLKGFLGMEYVDDVT--IRHL----YCNLKPYELHPVLKAVAQLQAESLHLSDEELQSI 206

  Fly   169 KIYESYKNVLIELHLDSNNSWYITGLKAIVFLAARNPHFQTMKAQNFIQDKLYNLLTKAEELVAP 233
            ..:: :|.::..:..|.       |||. .:...|:.:.:.:|.:..|.:.....:...|.....
 Worm   207 SGFD-FKQMMGTMFNDD-------GLKG-NYKQTRDINPERLKEKTDIVEAFGMEVVNFEFAGNL 262

  Fly   234 SKTI---RNVLCHRDTWDHNIVYYFNKESSVLPNACCIVDFQLTQYCSPTLDVLFLLYIVASAEV 295
            :|.:   ::||.|.|.|..||::   .|:....:|..::|:|:....:|..|::.:.....|...
 Worm   263 NKVVGIHKDVLVHGDLWAANILW---NENDGKFSASKVIDYQIIHMGNPAEDLVRVFLCTLSGAD 324

  Fly   296 RRAIYDECLEHYYK---------NLQHHLDRLGLDKNLITENNFRKECQRTRL--AALVIWALTE 349
            |:|.:::.||.:|:         .:.:.||:|             ||..|...  .:||:..|..
 Worm   325 RQAHWEKLLEQFYEYFLEALEDNEIPYTLDQL-------------KESYRLYFVTGSLVMLPLYG 376

  Fly   350 P--QTKMSPSISNRLRSEEPEKFDYY--LNCDRSELLLRVIE 387
            |  |||:|       .|::.|..:.|  :..:::|.||..:|
 Worm   377 PIAQTKLS-------YSKDTEHVEEYREILTEKAEKLLEDME 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 67/352 (19%)
T16G1.6NP_506234.2 DUF1679 8..417 CDD:369592 88/432 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D333735at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.