DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33511 and T16G1.3

DIOPT Version :9

Sequence 1:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_506237.2 Gene:T16G1.3 / 188553 WormBaseID:WBGene00011797 Length:389 Species:Caenorhabditis elegans


Alignment Length:281 Identity:60/281 - (21%)
Similarity:112/281 - (39%) Gaps:79/281 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 ECERKGVFQKESALYSQILPKIQKYATKKLYPKCYYSRNDILVLEDLTQDY-----------RHL 134
            |.|.:|:..:|..|| :|:.| .......:.||.::|:.  ...|:||:.:           |||
 Worm    76 EYEAQGLHNREVNLY-EIIGK-WNMDDVLMSPKVFFSKK--FDSENLTKGFFAMEYVDNAITRHL 136

  Fly   135 RANEYYTLDHYKI--VLEHLSELHAASIAW--EEKENV-------------------KIYESYKN 176
                |..|..|::  :|:.|:...|.|:..  .|:|:|                   .|:|..:.
 Worm   137 ----YINLKSYELHSILKSLAVFQAESLKLNKREQESVTGYDLEKIVGKMFSQNGLNSIFEQVRQ 197

  Fly   177 VLIELHLDSNNSWYITGLKAIVFLAARNPHFQTMKAQNFIQDKLYNLLTKAEELVAPSKTIRNVL 241
            :..|...::.:...:.|::.:.|...:|       ..|::..|                  :|||
 Worm   198 INKEELSEAADKIAVFGVELVNFDLVKN-------LNNYLGIK------------------KNVL 237

  Fly   242 CHRDTWDHNIVYYFNKESSVLPNACCIVDFQLTQYCSPTLDVLFLLYIVASAEVRRAIYDECLEH 306
            .|.|.|..||::..||:...:..   |:|:|.....:|..|::.|.....|...|:..:::.||.
 Worm   238 VHGDLWSANIMWKENKDEFRVDK---IIDYQSIHLGNPAEDLVRLFISTLSGSERQKYWEKLLEQ 299

  Fly   307 YY---------KNLQHHLDRL 318
            :|         ||:.:.|::|
 Worm   300 FYEYFIEALEDKNVPYTLEQL 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 60/281 (21%)
T16G1.3NP_506237.2 PKc_like 1..381 CDD:389743 60/281 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.