DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33511 and H06H21.8

DIOPT Version :9

Sequence 1:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001023255.1 Gene:H06H21.8 / 186700 WormBaseID:WBGene00019164 Length:388 Species:Caenorhabditis elegans


Alignment Length:320 Identity:72/320 - (22%)
Similarity:132/320 - (41%) Gaps:69/320 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NSQVDAGSKDL---MGYMGEYYKLHLEAEVKGDKKKYFLNYFIKSLPRKNEPQREECERKGVF-- 88
            :.:|||..:.|   ..:..|.|..||  :|.||..|...:.||| :||.:| ....||.:...  
 Worm    23 HEKVDASFEKLENAKSFWSEIYVAHL--KVVGDGVKVPESVFIK-VPRISE-NVLRCEDESAVNH 83

  Fly    89 ---------QKESALYSQI----LPKIQKYATKKLYPKCYYSRNDI-------LVLEDLTQD--- 130
                     :||:..|...    :|...       :||.|:: .||       :|.|:|::.   
 Worm    84 LNDVLLYYSKKENLFYKHFEYGSIPNFP-------FPKVYFT-EDINGEATGGIVAENLSEKVFA 140

  Fly   131 YRHLRANEYYTLDHYKI--VLEHLSELHAASIAWEEKENVKIYESYKNVLIE-LHLDSNNSWYIT 192
            ..|:..     |.|.:|  ::|.|:.||:..:..::|       ||....:| .|   ....:..
 Worm   141 VEHIPG-----LKHEQILRLMEALAGLHSFLMKRDDK-------SYVESFVEGAH---GRETFSE 190

  Fly   193 GLKAIVFLAARNPHFQTMKAQNFIQDKLYNLLTKAEELVAPSKT------IRNVLCHRDTWDHNI 251
            |::.::|..|..  .:.:..:.|..|::.|:....:..:....|      ...::||.|....|:
 Worm   191 GMQNMMFEEALT--LENVSPEVFGNDRIRNIKWSFDYSIKNKATADAISAFPGIICHADLNVTNV 253

  Fly   252 VYYFNKESSVLPNACCIVDFQLTQYCSPTLDVLFLLYIVASAEVRRAIYDECLEHYYKNL 311
            ::   |:.|.......|:|:|:....|...|::.:|.:..:.|:||.:....|:||:|.|
 Worm   254 LW---KKDSAKDEISAIIDYQMLFIGSIAFDIIRVLTLGLNREIRRKMTQNYLDHYHKTL 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 68/305 (22%)
H06H21.8NP_001023255.1 CHK 129..312 CDD:214734 43/202 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.