DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33511 and F20D6.5

DIOPT Version :9

Sequence 1:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_505104.3 Gene:F20D6.5 / 184724 WormBaseID:WBGene00017635 Length:376 Species:Caenorhabditis elegans


Alignment Length:223 Identity:49/223 - (21%)
Similarity:89/223 - (39%) Gaps:19/223 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IQKYATKKL-YPKCY-YSRNDILV--------LEDLTQDYRHLRANEYYTLDHYKIVLEHLSELH 156
            :||::.|.: |||.| ..:.||.|        :.:......||........|.....:::|:..|
 Worm    83 LQKFSDKNISYPKIYELEKMDISVDPIKQGHIIMEYMSGITHLYCYNNLKPDELIEPVKNLARFH 147

  Fly   157 AASIAWEEKENVKIYESY-KNVLIELHLDSNNSWYITGLKAIV--FLAARNPHFQTMKAQNFIQD 218
            :.....:|:|...:...: .:....|....|.:.:|...|..:  :|.::.......:....:..
 Worm   148 SIGAELDEEEGSNVPRDFLSSWFTTLFTQQNKNTFIGNWKGDLSDWLPSKVARDTIKELDGLLTP 212

  Fly   219 KLYNLLTKAEELVAPSKTIRNVLCHRDTWDHNIVYYFNKESSVLPNACCIVDFQLTQYCSPTLDV 283
            :::..|....:|..    ::.||||.|...||::|..:.:.|....|  |||||...:.:...|:
 Worm   213 EIFLKLNNDCQLTG----VQEVLCHGDYSFHNLLYEKHCDGSYKFRA--IVDFQSVNWGNAAQDL 271

  Fly   284 LFLLYIVASAEVRRAIYDECLEHYYKNL 311
            ..|.....|.:.||...|..|:.||..|
 Worm   272 SRLFVTAMSGKDRRDSEDRLLKIYYDEL 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 49/223 (22%)
F20D6.5NP_505104.3 PKc_like 11..369 CDD:389743 49/223 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.