DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33511 and C29F7.1

DIOPT Version :9

Sequence 1:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001379235.1 Gene:C29F7.1 / 183016 WormBaseID:WBGene00007810 Length:394 Species:Caenorhabditis elegans


Alignment Length:331 Identity:71/331 - (21%)
Similarity:131/331 - (39%) Gaps:60/331 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDLLSSEECHLIAQRTLS--VVKKDNVILINSQVDAGSKDLMGYMGEYYKLHLEAEVKGDKKKYF 63
            |.::...:.|..|::.|.  .:.|:.||.|.|....|  :.:|.:|        .:|........
 Worm    44 MSMIRKVQLHFDAEQELKHPNLPKNVVIKIASCAKLG--EGVGSVG--------VDVNKGNAAAI 98

  Fly    64 LNYFIKSLPRKNEPQREECERKGVFQKESALYSQILPKIQKYATKKLYPKCYYSRND------IL 122
            :..|:         ...||....||:|    |:.:..|:     ..:|  |.....|      ::
 Worm    99 MELFM---------HNTECNYYNVFRK----YTDLPMKV-----PVIY--CAAKAGDAEAPVPVI 143

  Fly   123 VLEDLTQDYRHLRANEYYTLDHYKIVLEHLSELHAASIAWEEKENVKIYESYKNVLIELHLDSNN 187
            |:|.......|...:.:.....:||| :.:..||..|:..||         :::||.:..:....
 Worm   144 VMEMFEDCTVHDLIDGFDKDQLFKIV-DEIVNLHIFSLTTEE---------WRSVLPDSAMRDTV 198

  Fly   188 SWYITGLKAIVFLAARNPHFQTMKAQNFIQ---DKLYNLLTKAEELVAPSKTIRNVLCHRDTWDH 249
            ..:...:|.|....|::|..:.:  ..:|:   ||..:.:||..:.....|. ::||.|.|.|..
 Worm   199 DLFEAMVKTIAENMAKSPGLEII--SKYIEKTFDKDPSFMTKFSDEYLEGKR-KSVLTHGDLWSP 260

  Fly   250 NIVYYFNKESSVLPNACCIVDFQLTQYCSPTLDVLFLLYIVASAEVRRAIYDECLEHYYKNLQHH 314
            .|::  :|:.    |...|:|:|:....||..|:..:|....|.|.|..:....|:||::.|...
 Worm   261 QILW--DKDD----NIAGIIDWQVGHQGSPMEDLHRILSTGTSVENRNKLTKPLLDHYFEKLSAG 319

  Fly   315 LDRLGL 320
            |:..|:
 Worm   320 LEEKGV 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 60/286 (21%)
C29F7.1NP_001379235.1 CHK 142..322 CDD:214734 46/198 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.