DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33511 and dhs-27

DIOPT Version :9

Sequence 1:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_508591.3 Gene:dhs-27 / 180632 WormBaseID:WBGene00000990 Length:320 Species:Caenorhabditis elegans


Alignment Length:88 Identity:21/88 - (23%)
Similarity:34/88 - (38%) Gaps:23/88 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KDNVILINSQVDAGSKDLMGYMGEYYKLHLEAEVKGDKKKYFLNYFIKSLPRKNEPQREECERKG 86
            ||...:|....|...|   .|:.|..|      .:|.||.|.:.   :::.:.|..::|..|:.|
 Worm    47 KDTWTVITGGTDGIGK---AYIEELCK------TRGLKKFYLIG---RNIDKLNNTKKELVEQHG 99

  Fly    87 V--------FQKESALYSQILPK 101
            .        |:|:..   ..|||
 Worm   100 CEVMCHVHDFEKDDL---SALPK 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 16/69 (23%)
dhs-27NP_508591.3 17beta-HSD1_like_SDR_c 48..294 CDD:187614 20/87 (23%)
adh_short 50..234 CDD:278532 19/85 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I8247
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I4116
Isobase 1 0.950 - 0 Normalized mean entropy S12617
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.