DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33511 and F58B4.5

DIOPT Version :9

Sequence 1:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_505788.1 Gene:F58B4.5 / 179513 WormBaseID:WBGene00010238 Length:423 Species:Caenorhabditis elegans


Alignment Length:347 Identity:74/347 - (21%)
Similarity:113/347 - (32%) Gaps:123/347 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VILINSQ---------VDAGSKD-------LMGYMGEYYKLHLEAEVKGDKKKYFLNYFIKSLPR 73
            |:.|:||         :|..|.|       |.| |||..:|....||        ..|  |.|.|
 Worm    74 VVKISSQLPFIEMTKLMDFSSGDEFWDDAKLKG-MGEVTRLLHNREV--------ATY--KILMR 127

  Fly    74 KNEPQ--REECERKGVFQKESALYSQILPKIQKYATKKLYPKCYY-SRNDILVLEDL-------- 127
            :..|:  ..:......|..|:        |::.|...:.||..:: ..::.:..|||        
 Worm   128 EKHPKIPFTKVYASKPFDDEN--------KLKAYLISEYYPNIHHIGMHESIPAEDLIPVIHAIA 184

  Fly   128 ----------TQDYRHLRANEYYTLDHYKIV----LEHLSELHAASIAWEEKENV----KIYESY 174
                      .::.::.|..::..:...:.:    :|.::.|..||...|..|.|    |||:.|
 Worm   185 AFSAIGMKLSEEETKYARGADFLDIVFGQFMDEKSIERMNVLLKASFPEEYLEKVEEMLKIYKDY 249

  Fly   175 KNVLIELHLDSNNSWYITGLKAIVFLAARNPHFQTMKAQNFIQDKLYNLLTKAEELVAPSKT--- 236
                                           :||....:||                  ..|   
 Worm   250 -------------------------------YFQPQMIKNF------------------KNTCQF 265

  Fly   237 --IRNVLCHRDTWDHNIVYYFNKESSVLPNACCIVDFQLTQYCSPTLDVLFLLYIVASAEVRRAI 299
              .:.||.|.|.|..|.:...:.|...|.   .|:|||.....:|..||..|.....|.:.||..
 Worm   266 FGYKPVLTHSDLWSSNFLCTRDGEKVTLK---AIIDFQTVSITTPAQDVGRLFASCLSTKDRREK 327

  Fly   300 YDECLEHYYKNLQHHLDRLGLD 321
            .|..||.||....:.||  |:|
 Worm   328 ADFLLEEYYNTFVNELD--GMD 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 64/311 (21%)
F58B4.5NP_505788.1 DUF1679 3..414 CDD:369592 74/347 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.