DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and Sfp24F

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001162870.1 Gene:Sfp24F / 8674016 FlyBaseID:FBgn0259958 Length:175 Species:Drosophila melanogaster


Alignment Length:137 Identity:52/137 - (37%)
Similarity:77/137 - (56%) Gaps:7/137 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 FIKINESYYVF-GQTKVNWYVAYENCRRLQSELVTFETAEEFDAIAAFLNARGDRSEHWTSGNDL 106
            |::|..|||:. .:.:.||:.|||.||:.|:||::.||.:|...::.:|.|......:||||.||
  Fly    38 FVRIGNSYYLIERKLQKNWFGAYEICRQQQAELISLETFDELRLVSEYLLANNIFERYWTSGTDL 102

  Fly   107 GKTGTHYWFSNAQLVTIKRWAPKQPDNAGGREHCIHLGYIYGYSTEFQLNDRPCHNHASSLFKYI 171
            |..|.|.||||.|.::...|...:|:|....|||..||..:..:....:|||.|:..:|    :|
  Fly   103 GTKGKHVWFSNGQPLSTDLWYGGEPNNKNNEEHCDELGSDFRPTKSPGMNDRNCNFESS----FI 163

  Fly   172 CE--APK 176
            ||  .||
  Fly   164 CEEVQPK 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 46/124 (37%)
Sfp24FNP_001162870.1 CLECT 45..165 CDD:153057 45/123 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10954
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I5416
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26853
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0001931
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
77.080

Return to query results.
Submit another query.