DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and asgrl3

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_021332405.1 Gene:asgrl3 / 799269 ZFINID:ZDB-GENE-060526-152 Length:311 Species:Danio rerio


Alignment Length:141 Identity:38/141 - (26%)
Similarity:55/141 - (39%) Gaps:21/141 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 FIKINESYYVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAI---AAFLNARGDRSEHWTSGN 104
            ::....|.|:|.:.|:||..|.:.|....:.|:..|...|.:.:   ..|:....:.:.:|....
Zfish   179 WVPFGNSCYLFSRDKMNWTEAKDYCEEKGAWLLKIEDDSEDEWVRNECQFVTDFANPTHYWIGLT 243

  Fly   105 DLGKTGTHYWFSNAQLVTIK-RWAPKQPD-----NAGGR-EHCIHLGYIYGYSTEFQLNDRPCHN 162
            | ..||...|.........| .|.|.|||     :.|.. |.|..:.|      |..|||.    
Zfish   244 D-QNTGQWRWADGTNYTMNKEHWGPGQPDEWTEHSLGEEGEDCAEITY------ESLLNDL---- 297

  Fly   163 HASSLFKYICE 173
            |.||..|:|||
Zfish   298 HCSSKIKFICE 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 36/133 (27%)
asgrl3XP_021332405.1 CLECT_DC-SIGN_like 179..309 CDD:153060 38/141 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.