DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and COLEC11

DIOPT Version :10

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001242914.1 Gene:COLEC11 / 78989 HGNCID:17213 Length:285 Species:Homo sapiens


Alignment Length:92 Identity:24/92 - (26%)
Similarity:43/92 - (46%) Gaps:11/92 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 IAAFLNARGDRSEHWTSGNDLGKTGTHYWFSNAQLVTIKRWAPKQPDNAGGREHCIHLGYIYGYS 150
            :||:| |:...:..:...|||.|.|...:..::.:.|..:|...:|:||...|.|:.:....|: 
Human   203 MAAYL-AQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGW- 265

  Fly   151 TEFQLNDRPCHNHASSLFKYICEAPKQ 177
                 ||..||    :...::||..|:
Human   266 -----NDVACH----TTMYFMCEFDKE 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 21/86 (24%)
COLEC11NP_001242914.1 Collagen 61..112 CDD:460189
CLECT_collectin_like 165..280 CDD:153061 22/87 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.