DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and Clec4a3

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001191170.1 Gene:Clec4a3 / 73149 MGIID:1920399 Length:237 Species:Mus musculus


Alignment Length:151 Identity:38/151 - (25%)
Similarity:55/151 - (36%) Gaps:39/151 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DMTPFIKINESYYVFGQTKV--NWYVAYENCRRLQSELVTFETAEEFDAIAAFLNARGDRSEHWT 101
            |..||    .||..|..|.:  :|..:.|||..:.:.||...:.||.|.|...|    |....:.
Mouse   110 DWKPF----GSYCYFTSTDLVASWNESKENCFHMGAHLVVIHSQEEQDFITGIL----DTGTAYF 166

  Fly   102 SGNDLGKTGTHYWFSNAQLVTIKRWAPKQP--DN---------AGGREHCIHLGYIYGYSTEFQL 155
            .|  |...|...|          :|..:.|  ||         :...|.|:.:.  :..||.:..
Mouse   167 IG--LSNPGDQQW----------QWIDQTPYDDNTTFWHKGEPSSDNEQCVIIN--HRQSTGWGW 217

  Fly   156 NDRPCHNHASSLFKYICEAPK 176
            :|.||.:..:|    ||...|
Mouse   218 SDIPCSDKQNS----ICHVKK 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 33/136 (24%)
Clec4a3NP_001191170.1 DUF2418 41..>82 CDD:287321
CLECT_DC-SIGN_like 107..230 CDD:153060 35/145 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.