DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and Colec11

DIOPT Version :10

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001300907.1 Gene:Colec11 / 71693 MGIID:1918943 Length:278 Species:Mus musculus


Alignment Length:74 Identity:20/74 - (27%)
Similarity:32/74 - (43%) Gaps:10/74 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 NDLGKTGTHYWFSNAQLVTIKRWAPKQPDNAGGREHCIHLGYIYGYSTEFQLNDRPCHNHASSLF 168
            |||.|.|...:...:.:.|..:|...:|:||...|.|:.:....|:      ||..||    ...
Mouse   213 NDLEKEGAFVYSDRSPMQTFNKWRSGEPNNAYDEEDCVEMVASGGW------NDVACH----ITM 267

  Fly   169 KYICEAPKQ 177
            .::||..|:
Mouse   268 YFMCEFDKE 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 17/68 (25%)
Colec11NP_001300907.1 Collagen 48..99 CDD:460189
CLECT_collectin_like 158..273 CDD:153061 18/69 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.