DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and Cd209f

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_081232.2 Gene:Cd209f / 69142 MGIID:1916392 Length:255 Species:Mus musculus


Alignment Length:127 Identity:30/127 - (23%)
Similarity:51/127 - (40%) Gaps:15/127 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SYYVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAIAAFLNARGDRSEHWTSGNDLGKTGTHY 113
            |.|:|.:|..:|..:..:|..|.:.||...:..| .....:.|.|.:: ..|...:|....|:..
Mouse   137 SCYLFSRTLGSWETSASSCEDLGAHLVIVNSVSE-QRFMKYWNVRKNQ-RSWIGLSDHIHEGSWQ 199

  Fly   114 WFSNAQLVTIKRWAPKQPDNAGGREHCIHLGYIYGYSTEFQLNDRPCHNHASSLFKYICEAP 175
            |...:.| ....|...:|:| .|.|.|:.|     :..::  ||..|.....    ::||.|
Mouse   200 WVDGSAL-KFSFWKEGEPNN-DGDEDCVEL-----FMDDW--NDNKCTEQNF----WVCEQP 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 27/123 (22%)
Cd209fNP_081232.2 CLECT_DC-SIGN_like 127..246 CDD:153060 27/123 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.