DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and si:dkey-9i23.5

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001139081.1 Gene:si:dkey-9i23.5 / 571862 ZFINID:ZDB-GENE-090313-364 Length:189 Species:Danio rerio


Alignment Length:136 Identity:27/136 - (19%)
Similarity:57/136 - (41%) Gaps:15/136 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YVFGQTKVNWYVAYENCRRLQ--SELVTFETAEEFDAIAAFLNARGDRS-EHWTSGNDLGKTGTH 112
            |.|  :::|:.:|...||...  :.||:...:::.:.:...:.....:| ..|....:..|:|..
Zfish    62 YFF--SRLNFTLAEFKCRSKAPGAHLVSVHNSQDNNYLLCIVKKFNPKSLRIWLGAYEFFKSGEF 124

  Fly   113 YWFSNAQLVTIKRWAPKQPDNA-GGREHCIHLGYIYGYSTEFQLNDRPCHNHASSLFKYICEAPK 176
            :|. :.......||.|.:|::. ...|.|:.:    .:....:.||..|:...|    :||...:
Zfish   125 FWL-DGSFWNFNRWVPGEPNHMYTSNEECLEM----NWKEAGKWNDDKCNVRKS----FICAFKR 180

  Fly   177 QETVSI 182
            :|.:.|
Zfish   181 KEFMEI 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 24/125 (19%)
si:dkey-9i23.5NP_001139081.1 CLECT 58..176 CDD:153057 23/124 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.