DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and clec19a

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001315005.1 Gene:clec19a / 570145 ZFINID:ZDB-GENE-080917-46 Length:207 Species:Danio rerio


Alignment Length:197 Identity:44/197 - (22%)
Similarity:74/197 - (37%) Gaps:38/197 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 QLFLVV--AGFAPGFGYDKYTTHIQ-----------NGNPYNLTVDMTPFIKINESY-YVFGQTK 57
            :|||.:  :||:   .:...:|:|:           :..|....:..|.|    |.| |.|....
Zfish    23 ELFLALLFSGFS---AWALPSTNIKITQALPMQLSDSNQPVTCPLFWTEF----EGYCYRFFPLN 80

  Fly    58 VNWYVAYENCRRL-----QSELVTFETAEEFDAIAAFLNAR--GDRSEHWTSGNDLGKTGTHYWF 115
            ..|..|...|...     .::|.:..:.||...:...:|:|  |..::.|...:|..:.||..| 
Zfish    81 RTWAEADLYCAEFSNGHKSAKLTSVHSWEENVFVYDLVNSRMPGIPTDIWIGLHDRRQEGTMEW- 144

  Fly   116 SNAQLVTIKRWAPKQPDNAGGR----EHCIHLGYIYGYSTEFQLNDRPCHNHASSLFKYICEAPK 176
            ::........|...|||:...|    |.|:.:.|... |.....||    |:....|.::|:.|.
Zfish   145 TDGSPFEYSYWDGNQPDDGIHRIPEEEDCVEIWYRQN-SALRSWND----NNCDKAFPFVCKIPT 204

  Fly   177 QE 178
            .|
Zfish   205 LE 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 30/135 (22%)
clec19aNP_001315005.1 CLECT_CEL-1_like 62..202 CDD:153059 34/149 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.