DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and si:ch211-282j17.3

DIOPT Version :10

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001025393.1 Gene:si:ch211-282j17.3 / 568449 ZFINID:ZDB-GENE-041210-287 Length:370 Species:Danio rerio


Alignment Length:135 Identity:32/135 - (23%)
Similarity:58/135 - (42%) Gaps:18/135 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAIAAFLNARGDR-SEHWTSGNDLGKTGTHYWF 115
            ||....:||..|...||:...:||:.....|...:..|:|.|... |..|     :|.....:.:
Zfish   140 VFVDQLMNWRAAQSYCRQNHIDLVSVRNQNESQQLEKFINDRNSSGSAVW-----IGLFRDTWQW 199

  Fly   116 SNAQLVTIKRWAPKQPDNAGGREHCIHLGYIYGYSTEFQLNDRPCHNHASSLFKYICEAPK---- 176
            |:....:.:.|...:|:||||.::||.:    ..:.:.:.:|..|    :..|.::|...|    
Zfish   200 SDQSNSSFRYWNTAEPNNAGGIQNCIGM----NQNAQGRWHDISC----TGSFPFVCHEDKLIVI 256

  Fly   177 QETVS 181
            |:.:|
Zfish   257 QQNLS 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 28/121 (23%)
si:ch211-282j17.3NP_001025393.1 CLECT 24..134 CDD:470576
CLECT_1 139..249 CDD:153072 28/121 (23%)
CLECT 255..367 CDD:153057 2/7 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.