DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and si:ch211-125e6.13

DIOPT Version :10

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001153806.1 Gene:si:ch211-125e6.13 / 566620 ZFINID:ZDB-GENE-070912-37 Length:151 Species:Danio rerio


Alignment Length:127 Identity:30/127 - (23%)
Similarity:50/127 - (39%) Gaps:34/127 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 TKVNWYVAYENCRRLQSELVTFETAEEFDAIAAFL-NAR---------GDRSEHWTSGNDLGKTG 110
            |.|||..|.:||:||...|.:.....|.|.:.:.: |::         .:::..|:.|:..|.| 
Zfish    41 TSVNWATAEKNCQRLGGNLASVLNDVENDFLLSLIPNSKRFFIGGYNVDEQNWFWSDGSPFGYT- 104

  Fly   111 THYWFSNAQLVTIKRWAPKQPDNAGGREHCIHLGYIYGYSTEFQLNDRPCHNHASSLFKYIC 172
                          .|...:|:|. ..|||:.:    .::.....|:.||    |....|||
Zfish   105 --------------NWCSGEPNNM-NTEHCLEI----NWTANRCWNNLPC----SVELGYIC 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 30/127 (24%)
si:ch211-125e6.13NP_001153806.1 CLECT 34..145 CDD:153057 30/127 (24%)

Return to query results.
Submit another query.