DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and Clec4n

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_064385.1 Gene:Clec4n / 56620 MGIID:1861231 Length:209 Species:Mus musculus


Alignment Length:123 Identity:30/123 - (24%)
Similarity:53/123 - (43%) Gaps:13/123 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 TKVN-WYVAYENCRRLQSELVTFETAEEFDAIAAFLNARGDRSEHWTSGNDLGKTGTHYWFSNAQ 119
            ||.| |..:.:||.::.:.||...|..|.:.|...||   :...::...:|....|...|..:..
Mouse    95 TKENFWSTSEQNCVQMGAHLVVINTEAEQNFITQQLN---ESLSYFLGLSDPQGNGKWQWIDDTP 156

  Fly   120 L-VTIKRWAPKQPDNAGGREHCIHLGYIYGYSTEFQLNDRPCHNHASSLFKYICEAPK 176
            . ..::.|.|.:|:..  .|.|:.:  :|...:::..||..|.:..:|    |||..|
Mouse   157 FSQNVRFWHPHEPNLP--EERCVSI--VYWNPSKWGWNDVFCDSKHNS----ICEMKK 206

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 27/118 (23%)
Clec4nNP_064385.1 CLECT_DC-SIGN_like 79..204 CDD:153060 28/119 (24%)
Alpha-D-mannopyranose binding. /evidence=ECO:0000250|UniProtKB:Q6EIG7 168..170 0/1 (0%)