DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and Clec4e

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_064332.1 Gene:Clec4e / 56619 MGIID:1861232 Length:214 Species:Mus musculus


Alignment Length:157 Identity:34/157 - (21%)
Similarity:59/157 - (37%) Gaps:17/157 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 YDKYTTHIQNGNPYNLTVDMTPFIKINESYYVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDA 85
            |.:.:..::|..|.|       :.....|.|.|..|.:.|..:.:||..:.:.||..:|.||.:.
Mouse    69 YSEASGSVKNCCPLN-------WKHYQSSCYFFSTTTLTWSSSLKNCSDMGAHLVVIDTQEEQEF 126

  Fly    86 IAAFLNARGDRSEHWTSGNDLGKTGTHYWFSNAQLV-TIKRWAPKQPDNAGGREHCIHLGYIYGY 149
            :   ...:..|.|.:....|....|...|..:.... ::..|...:|:|....|.|..:.  ...
Mouse   127 L---FRTKPKRKEFYIGLTDQVVEGQWQWVDDTPFTESLSFWDAGEPNNIVLVEDCATIR--DSS 186

  Fly   150 STEFQLNDRPCHNHASSLFKYICEAPK 176
            ::....||.||...    ..:|||.|:
Mouse   187 NSRKNWNDIPCFYS----MPWICEMPE 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 27/124 (22%)
Clec4eNP_064332.1 CLECT_DC-SIGN_like 80..207 CDD:153060 30/142 (21%)
Confers specificity for glucose/mannose-type carbohydrates. /evidence=ECO:0000250|UniProtKB:Q9ULY5 169..171 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I5406
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.150

Return to query results.
Submit another query.