DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and zgc:174904

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001170922.1 Gene:zgc:174904 / 564690 ZFINID:ZDB-GENE-080204-76 Length:320 Species:Danio rerio


Alignment Length:138 Identity:37/138 - (26%)
Similarity:50/138 - (36%) Gaps:23/138 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 NESYYVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAIAAFLNARGDRSEHWTSGNDLGKTGT 111
            |.|.|....|..:|..:...|:|....|....||||...|...| .||..:..|...:|......
Zfish   194 NGSCYFISVTTRSWTDSQTYCKRYGGHLAIILTAEEQTFIWDLL-PRGYWNAFWFGISDEKVEDD 257

  Fly   112 HYWFSNAQLVTIKRWAPKQPDNAGGREHCIHLGYIYGYSTEFQL---------NDRPCHNHASSL 167
            .:|....:||. ..|...:|:|        |:....||..:..:         .|.|||   .||
Zfish   258 WHWVDGTKLVG-GFWEDGEPNN--------HIDEDCGYMIKTDVLTRVAIKSWYDAPCH---MSL 310

  Fly   168 FKYICEAP 175
             .:|||.|
Zfish   311 -PWICEKP 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 33/132 (25%)
zgc:174904NP_001170922.1 CLECT_DC-SIGN_like 186..316 CDD:153060 35/135 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10954
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.100

Return to query results.
Submit another query.