powered by:
Protein Alignment lectin-37Da and zgc:194252
DIOPT Version :9
Sequence 1: | NP_001014489.1 |
Gene: | lectin-37Da / 3346222 |
FlyBaseID: | FBgn0053532 |
Length: | 186 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001122180.1 |
Gene: | zgc:194252 / 561367 |
ZFINID: | ZDB-GENE-081022-86 |
Length: | 251 |
Species: | Danio rerio |
Alignment Length: | 74 |
Identity: | 13/74 - (17%) |
Similarity: | 36/74 - (48%) |
Gaps: | 14/74 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 51 YVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAIAA---------FLNARGDRSEH-WTSGND 105
:.|....::|..|.:.||:...:|.|. .:::.:|::: ::..:.:|::. |::|.:
Zfish 24 HFFVNKTLSWQDAQKYCRQNYDDLSTV-GSKDLEALSSNPLIKEDYFWIGLQNNRNQWIWSTGEE 87
Fly 106 LGKTGTHYW 114
...| :|
Zfish 88 ARVT---FW 93
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
lectin-37Da | NP_001014489.1 |
CLECT |
49..173 |
CDD:153057 |
13/74 (18%) |
zgc:194252 | NP_001122180.1 |
CLECT |
22..131 |
CDD:295302 |
13/74 (18%) |
CLECT |
128..244 |
CDD:214480 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR22802 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.