DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and zgc:194252

DIOPT Version :10

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001122180.1 Gene:zgc:194252 / 561367 ZFINID:ZDB-GENE-081022-86 Length:251 Species:Danio rerio


Alignment Length:74 Identity:13/74 - (17%)
Similarity:36/74 - (48%) Gaps:14/74 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAIAA---------FLNARGDRSEH-WTSGND 105
            :.|....::|..|.:.||:...:|.|. .:::.:|:::         ::..:.:|::. |::|.:
Zfish    24 HFFVNKTLSWQDAQKYCRQNYDDLSTV-GSKDLEALSSNPLIKEDYFWIGLQNNRNQWIWSTGEE 87

  Fly   106 LGKTGTHYW 114
            ...|   :|
Zfish    88 ARVT---FW 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 13/74 (18%)
zgc:194252NP_001122180.1 CLECT 22..131 CDD:470576 13/74 (18%)
CLECT 128..244 CDD:214480
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.