DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and lectin-21Ca

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster


Alignment Length:153 Identity:37/153 - (24%)
Similarity:64/153 - (41%) Gaps:28/153 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NLTVDM----------TPFIKIN-ESYYVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAIAA 88
            ||:|:.          :.|.||. ..:::..:.||:|:.|...|.::.:.|:|.::.:|.|||..
  Fly   127 NLSVEAKKVMPKTEIPSQFQKIGWRHFFIEKKHKVDWFKATSMCHKMGAHLLTIQSEDELDAIRT 191

  Fly    89 FLNARGDRS-EHWTSGNDLGKTGTHYWFSNAQLVTIKRWAPKQPDNAGGREHCIHL--GYIYGYS 150
            .|....|.| :.|...||:.|.|.....:........:|...:| .....:.|:||  |      
  Fly   192 ELKDINDGSHDFWLDINDIAKWGEFISLATGMNPPFLKWHKHRP-QVQIHQRCVHLRGG------ 249

  Fly   151 TEFQLNDRPCHNHASSLFKYICE 173
               ::.|..|    |..|.:||:
  Fly   250 ---EMMDGKC----SEQFLFICQ 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 30/126 (24%)
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 30/120 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448830
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.