DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and lectin-24Db

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster


Alignment Length:130 Identity:33/130 - (25%)
Similarity:57/130 - (43%) Gaps:19/130 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YYVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAIAAFLNARGDRSEHWTSGNDLGKTGTHYW 114
            :|:..:...:|..|.:.||.:...:...:..||.|||    :||.|...:|...|||..:.|:..
  Fly   246 FYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAI----SARLDDKSYWLGINDLQSSNTYVS 306

  Fly   115 FSNAQLVTIKRWAPKQPDNAGGREHCIHLGYIYGYSTEFQLNDRPCH--NHASSLFKYICEAPKQ 177
            .::.:.|....|...:|::....|:|:.|       ...::||.|||  .|.      ||:..|:
  Fly   307 VASGREVEFLNWNAGEPNHGNEDENCVEL-------IRSKMNDDPCHRKKHV------ICQTDKE 358

  Fly   178  177
              Fly   359  358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 31/124 (25%)
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625
CLECT 247..354 CDD:153057 31/123 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.