DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and Clec4f

DIOPT Version :10

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_058031.2 Gene:Clec4f / 51811 MGIID:1859834 Length:548 Species:Mus musculus


Alignment Length:116 Identity:26/116 - (22%)
Similarity:44/116 - (37%) Gaps:28/116 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DRILDDVG---GAFAMGAVGGSAYHLI-----RGIYNSPGGAR----------LSGGVQALRMSG 59
            |:::.|||   |..:|.|....|..::     ..||.:....|          :.|.::.:.:..
Mouse   237 DKVVLDVGCGTGILSMFAAKAGAKKVVAVDQSEIIYQAMDIVRSNNLEDTITLIKGRIEEIDLPV 301

  Fly    60 PRSGGSFSVWGGLYSTFDCAL---VYARQK---ED----PWNSILSGAATG 100
            .:.....|.|.|.:..|...|   :|||.:   :|    |....:|.||.|
Mouse   302 EKVDIIISEWMGYFLLFGSMLDSVLYARDRYLADDGLVFPDRCSISLAAVG 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 15/62 (24%)
Clec4fNP_058031.2 DUF2615 <13..93 CDD:402563
SMC_prok_B <83..403 CDD:274008 26/116 (22%)
CLECT_DC-SIGN_like 414..538 CDD:153060
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.