DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and CD207

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_056532.4 Gene:CD207 / 50489 HGNCID:17935 Length:328 Species:Homo sapiens


Alignment Length:134 Identity:41/134 - (30%)
Similarity:57/134 - (42%) Gaps:23/134 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SYYVFGQTKVNWYVAYENCRRLQSEL--VTFETAEEFDAIAAFLNARGDRSEHWTSGNDLGKTGT 111
            ::|.|......||.|.:.|....|.|  ||.|:.:||    .:..|.|  ..:|......|..|.
Human   205 NFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEF----LYKTAGG--LIYWIGLTKAGMEGD 263

  Fly   112 HYW-----FSNAQLVTIKRWAPKQPDNAGGREHCIHLGYIYGYSTEFQLNDRPCHNHASSLFKYI 171
            ..|     |:..|  :::.|.|.:|:|||..|||   |.|...|.: ..||.||    ...|.:|
Human   264 WSWVDDTPFNKVQ--SVRFWIPGEPNNAGNNEHC---GNIKAPSLQ-AWNDAPC----DKTFLFI 318

  Fly   172 CEAP 175
            |:.|
Human   319 CKRP 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 39/130 (30%)
CD207NP_056532.4 CLECT_DC-SIGN_like 196..321 CDD:153060 40/131 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 1 Normalized mean entropy S7305
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.