DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and Cd207

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_578352.4 Gene:Cd207 / 502852 RGDID:1565913 Length:332 Species:Rattus norvegicus


Alignment Length:132 Identity:36/132 - (27%)
Similarity:56/132 - (42%) Gaps:19/132 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SYYVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAIAAFLNARGDRSEHWTSGNDLGKTGTHY 113
            ::|.|.:|...||.|.:.|...::.|.:..:..|.:    ||....|...||......|..|..|
  Rat   209 NFYYFSRTPKTWYSAEQYCISRKAHLTSVSSESEHE----FLYKVADGIPHWIGLTKAGSEGDWY 269

  Fly   114 W-----FSNAQLVTIKRWAPKQPDNAGGREHCIHLGYIYGYSTEFQLNDRPCHNHASSLFKYICE 173
            |     |:..|  :.:.|.|.:|:|....|||.::    ..|.....||.||.|    ::.:||:
  Rat   270 WVDQTSFNKEQ--SRRFWIPGEPNNVRNNEHCANI----RVSALKCWNDSPCDN----VYSFICK 324

  Fly   174 AP 175
            .|
  Rat   325 MP 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 34/128 (27%)
Cd207XP_578352.4 DUF881 127..>190 CDD:303034
CLECT_DC-SIGN_like 202..325 CDD:153060 35/129 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.