DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and Cd209e

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_006248837.1 Gene:Cd209e / 501797 RGDID:1563333 Length:215 Species:Rattus norvegicus


Alignment Length:142 Identity:39/142 - (27%)
Similarity:67/142 - (47%) Gaps:30/142 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DMTPFIKINESYYVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAIAAFLNARGDRSEH-WTS 102
            |.|.|   |.:.|.|.:::.:|:.:...|:.::::|||.::.||    .:||.....::.: |..
  Rat    88 DWTFF---NGNCYFFSKSQRDWHNSITACQEMEAQLVTIKSPEE----QSFLQQTSKKNGYTWMG 145

  Fly   103 GNDLGKTGTHYWFSNAQLVTIKR--WAPKQPDNAGGREHCIHLGYIYGYSTEFQ---LNDRPCHN 162
            .:||.|.|..||...:.|....|  |...||:|..|:: |:          ||:   .||..|.|
  Rat   146 LSDLNKEGEWYWLDGSPLSDSLRNYWNEGQPNNIDGQD-CV----------EFRNDGWNDAKCDN 199

  Fly   163 HASSLFKY-ICE 173
                 :|: ||:
  Rat   200 -----WKFWICK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 34/130 (26%)
Cd209eXP_006248837.1 CLECT_DC-SIGN_like 85..207 CDD:153060 39/142 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I5307
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.