DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and Clec4a4

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001005860.1 Gene:Clec4a4 / 474145 MGIID:3624119 Length:236 Species:Mus musculus


Alignment Length:212 Identity:45/212 - (21%)
Similarity:77/212 - (36%) Gaps:60/212 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKTLVQLFLVVA-GFAPGF--GYDKYT-----------------THIQNGNPYNLTV------D 39
            :|.:|:.|.|::| .|...|  .:.||:                 ..|:||:.....|      |
Mouse    46 LLTSLMLLLLLLAITFLVAFIIYFQKYSQLLEEKEAAKNIMYKELNCIKNGSLMEDKVWSCCPKD 110

  Fly    40 MTPFIKINESYYVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAIAAFLNA----------RG 94
            ..||  ::..|::...:|.:|..:.|.|..:.:.||...:..|.|.|.:.||.          .|
Mouse   111 WKPF--VSHCYFILNDSKASWNESEEKCSHMGAHLVVIHSQAEQDFITSNLNTSAGYFIGLLDAG 173

  Fly    95 DRSEHWTSGNDLGKTGTHYWFSNAQLVTIKRWAPKQPDNAGGREHCIHLGYIYGYSTEFQLNDRP 159
            .|...|.......|:.|.             |...:|:.  ..|.|:.:.:   .:|.:..||.|
Mouse   174 QRQWRWIDQTPYNKSATF-------------WHKGEPNQ--DWERCVIINH---KTTGWGWNDIP 220

  Fly   160 CHNHASSLFKYICEAPK 176
            |.:..:|    :|:..|
Mouse   221 CKDEHNS----VCQVKK 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 27/133 (20%)
Clec4a4NP_001005860.1 CLECT_DC-SIGN_like 107..230 CDD:153060 30/146 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.