DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and Clec4e

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001005897.2 Gene:Clec4e / 450223 RGDID:1359298 Length:215 Species:Rattus norvegicus


Alignment Length:179 Identity:38/179 - (21%)
Similarity:62/179 - (34%) Gaps:35/179 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KTLVQL--FLVVAGFAPGFGYDKYTTHIQNGNPYNLTVDMTPFIKINESYYVFGQTKVNWYVAYE 65
            ||:.:|  :|..:|            .::|..|.|       :.....|.|.|..|.:.|..:..
  Rat    62 KTIKELSCYLEASG------------SVKNCCPLN-------WKHFQSSCYFFSTTTLTWPSSLN 107

  Fly    66 NCRRLQSELVTFETAEEFDAIAAFLNARGDRSEHWTSGNDLGKTGTHYWFSNAQLV-TIKRWAPK 129
            ||..:.:.||...|.||.:.:   ...:..:.|.:....|....|...|..:.... ::..|...
  Rat   108 NCSDMGAHLVVINTWEEQEFL---FRTKPRKKEFYIGLTDQVVEGQWRWVDDTPFTESLSFWDAG 169

  Fly   130 QPDNAGGREHCIHLGYIYGYSTEFQLNDRPCHNHASSLFK--YICEAPK 176
            :|:|....|.|.        :.....|.|...|..|..|.  :|||.|:
  Rat   170 EPNNIVFVEDCA--------TMRDSSNPRKNWNDVSCFFSMPWICEMPE 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 27/126 (21%)
Clec4eNP_001005897.2 CLECT_DC-SIGN_like 81..208 CDD:153060 30/144 (21%)
Confers specificity for glucose/mannose-type carbohydrates. /evidence=ECO:0000250|UniProtKB:Q9ULY5 170..172 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I5307
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.150

Return to query results.
Submit another query.