DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and ASGR1

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001662.1 Gene:ASGR1 / 432 HGNCID:742 Length:291 Species:Homo sapiens


Alignment Length:149 Identity:36/149 - (24%)
Similarity:56/149 - (37%) Gaps:22/149 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GNPYNLTVDMTPFIKINESYYVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAIAAFLNARGD 95
            ||....|.....:::...|.|.|.::...|..|...||...:.||...:.||    ..|:.....
Human   146 GNGSERTCCPVNWVEHERSCYWFSRSGKAWADADNYCRLEDAHLVVVTSWEE----QKFVQHHIG 206

  Fly    96 RSEHWTSGNDLGKTGTHYWFSNAQLVT-IKRWAPKQPDN-----AGGREHCIHLGYIYGYSTEFQ 154
            ....|...:|  :.|...|.......| .|.|.|:|||:     .||.|.|.|      ::.:.:
Human   207 PVNTWMGLHD--QNGPWKWVDGTDYETGFKNWRPEQPDDWYGHGLGGGEDCAH------FTDDGR 263

  Fly   155 LNDRPCHNHASSLFKYICE 173
            .||..|...    ::::||
Human   264 WNDDVCQRP----YRWVCE 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 31/129 (24%)
ASGR1NP_001662.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
Endocytosis signal. /evidence=ECO:0000255 5..8
Lectin_N 17..144 CDD:309178
CLECT_DC-SIGN_like 154..279 CDD:153060 33/141 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.