DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and tfc

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster


Alignment Length:176 Identity:47/176 - (26%)
Similarity:72/176 - (40%) Gaps:29/176 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 YDKYTTHIQNGNPYNLTVD-----------------MTPFIKINESYYVFG-QTKVNWYVAYENC 67
            :|:|..:|.:.:|....||                 ..|.:|:.|..|..| ..|.||:.|.:.|
  Fly   203 HDQYYGNIFHRDPSENEVDNDCPNCVDESQYTPNKWTMPLLKLGEKRYYLGIFFKANWFKATQYC 267

  Fly    68 RRLQSELVTFETAEEFDAIAAFLNARGDRSEH-WTSGNDLGKTGTHYWFSNAQLVTIKRWAPKQP 131
            |.....|.:..:.||.|.:...:...|...|| |.||.||...|..:|.:..:.:|...|...:|
  Fly   268 RYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWMATGRPITFTNWNAGEP 332

  Fly   132 DN----AGGREHCIHLGYIYGYSTEFQLNDRPCHNHASSLFKYICE 173
            :|    .|..|:|:.|....|...::  ||.||    |....::||
  Fly   333 NNFRYENGEEENCLELWNRDGKGLKW--NDSPC----SFETYFVCE 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 36/129 (28%)
tfcNP_612091.1 CLECT 249..373 CDD:153057 38/130 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 1 1.000 - - FOG0001931
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.