DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and Colec11

DIOPT Version :10

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001414101.1 Gene:Colec11 / 366588 RGDID:1309678 Length:277 Species:Rattus norvegicus


Alignment Length:74 Identity:19/74 - (25%)
Similarity:32/74 - (43%) Gaps:10/74 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 NDLGKTGTHYWFSNAQLVTIKRWAPKQPDNAGGREHCIHLGYIYGYSTEFQLNDRPCHNHASSLF 168
            |||.:.|...:...:.:.|..:|...:|:||...|.|:.:....|:      ||..||    ...
  Rat   212 NDLEREGAFVYSDRSPMQTFNKWRSGEPNNAYDEEDCVEMVASGGW------NDVACH----ITM 266

  Fly   169 KYICEAPKQ 177
            .::||..|:
  Rat   267 YFMCEFDKE 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 16/68 (24%)
Colec11NP_001414101.1 None

Return to query results.
Submit another query.