DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and Klrb1a

DIOPT Version :10

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001010964.1 Gene:Klrb1a / 362443 RGDID:1586149 Length:223 Species:Rattus norvegicus


Alignment Length:98 Identity:16/98 - (16%)
Similarity:35/98 - (35%) Gaps:17/98 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QNGNPYNLTVDMTPFIKINESYYVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAIAAFLNAR 93
            :.|:|..|..........::.::| .||.:.|..:..:|....:.|:..:..||.    .||.  
  Rat    85 KTGSPAKLKCPKDWLSHRDKCFHV-SQTSITWKESLADCGGKGATLLLVQDQEEL----RFLR-- 142

  Fly    94 GDRSEHWTSGNDLGKTGTHYWFSNAQLVTIKRW 126
                      |...:..:.:|...:..::.:.|
  Rat   143 ----------NLTKRISSSFWIGLSYTLSDENW 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 13/78 (17%)
Klrb1aNP_001010964.1 LCK-binding motif 32..35
CLECT_NK_receptors_like 94..212 CDD:153063 13/89 (15%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.