DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and Clec4d

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001003707.1 Gene:Clec4d / 362432 RGDID:1303339 Length:218 Species:Rattus norvegicus


Alignment Length:131 Identity:34/131 - (25%)
Similarity:46/131 - (35%) Gaps:21/131 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YYVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAIAAFLNARGDRSEHWTSGNDLGKT-GTHY 113
            |:.....: .|:.:..||..:.|.|||..|..|.|.:...|    |....:..|....|. |...
  Rat    94 YFALNDNQ-TWHESERNCSGMSSHLVTINTEAEQDFVTQLL----DEQFSYFLGLSYEKVEGQWQ 153

  Fly   114 WFS----NAQLVTIKRWAPKQPDNAGGREHCIHLGYIYGYSTEFQLNDRPCHNHASSLFKYICEA 174
            |..    |..:|..|...||.    ...|.|:.|.|   ...::..||.|||.....    ||:.
  Rat   154 WVDKTPFNPNVVFWKVGEPKD----SMEEDCVVLVY---DQDKWVWNDFPCHFEMGR----ICKL 207

  Fly   175 P 175
            |
  Rat   208 P 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 32/127 (25%)
Clec4dNP_001003707.1 CLECT_DC-SIGN_like 82..206 CDD:153060 32/127 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.