DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and Clec4a3

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001005891.1 Gene:Clec4a3 / 362431 RGDID:1359528 Length:237 Species:Rattus norvegicus


Alignment Length:153 Identity:31/153 - (20%)
Similarity:49/153 - (32%) Gaps:43/153 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DMTPFIKINESYYVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAIAAFLNARGDRSEHWTSG 103
            |..||  .:..|:....:..:|..:.|.|..:.:.||...:.||.|.:...|:.      |....
  Rat   110 DWKPF--DSNCYFPSTDSVESWMESEEKCSGIGAHLVVIHSQEEQDFLPRILDT------HAAYF 166

  Fly   104 NDLGKTGTHYWFSNAQLVTIKRWAPKQPDN-----------AGGREHCI----HLGYIYGYSTEF 153
            ..|...|...|          :|..:.|.|           :...|.|:    |....:|:|   
  Rat   167 IGLSDPGHRQW----------QWVDQTPYNGNATFWHEGEPSSDNEQCVIINHHENTGWGWS--- 218

  Fly   154 QLNDRPCHNHASSLFKYICEAPK 176
               |..|    |...|.:|:..|
  Rat   219 ---DSSC----SDKQKLVCQVKK 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 26/138 (19%)
Clec4a3NP_001005891.1 CLECT_DC-SIGN_like 107..231 CDD:153060 29/148 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.