DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and CG7763

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001356891.1 Gene:CG7763 / 36235 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster


Alignment Length:178 Identity:38/178 - (21%)
Similarity:67/178 - (37%) Gaps:56/178 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LVVAGFAPGFGYDKYTTHIQNGNPYNLTVDMTPFIKINESYYVFGQTKVNWYVAYENCRRLQSEL 74
            |:..|.|.|...::.....|.|:.|               ||:..:.|:||:.|.:.|.::...|
  Fly    92 LLTHGTAMGRKLEENEIFQQLGSKY---------------YYIEKEEKLNWHDALDKCHKMGGHL 141

  Fly    75 VTFETAEEFDAIAAFLNARGDRSEHWTSGNDLGKTGTHYW------FSNAQLVTIKR-------- 125
            .:.::.||.|.....||..                 ..||      |:.::.|::.:        
  Fly   142 ASLQSQEELDRFNNQLNGL-----------------NRYWIDVTNQFNESEFVSVTKGSKANFLS 189

  Fly   126 WAPKQPDNAGGREHCIHLGYIYGYSTEFQLNDRPCHNHASSLFKYICE 173
            ||..:|...|   .|:.:....|.:|   :||..|.   ::|: :|||
  Fly   190 WADGEPTKDG---ECVDIRTFNGKTT---MNDNSCF---ANLY-FICE 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 29/137 (21%)
CG7763NP_001356891.1 CLECT 116..228 CDD:153057 32/154 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448796
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.