DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and clec-32

DIOPT Version :10

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001023952.1 Gene:clec-32 / 3565962 WormBaseID:WBGene00009860 Length:365 Species:Caenorhabditis elegans


Alignment Length:217 Identity:49/217 - (22%)
Similarity:77/217 - (35%) Gaps:69/217 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KTLVQLFLVVAGFAPGFGYDKYTTHIQNGNPY---------------NLTVDMTPFIKINESYYV 52
            :||...|||:..:....| ..|.|.|...:.:               :.|..:|| ...|.:..|
 Worm    43 QTLYATFLVLLTYFLTKG-RVYETEIVTSSTFPALPSTSSKADSTSASTTTLLTP-APSNINTCV 105

  Fly    53 FGQTKVNWYVAYENCRRLQSELVTFETA------------------EEFDAIAAFL-NARGDRSE 98
            ||.|.:|     ..|.||.::..|.|.|                  :|.:||..|: |:..|  .
 Worm   106 FGFTYIN-----GKCWRLFTDPQTRENADSVCMSYGGSTLFSIRNEQENNAIFDFVSNSSVD--Y 163

  Fly    99 HWT----SGNDLG------KTGTHYWFSNAQLVTIKRWAPKQPDNAGGREHCIHLGYIYGYSTEF 153
            .||    .||.:.      ::|:...:.|        ::...||.|.|  .|::  :|...|...
 Worm   164 FWTGLICKGNTISSCIWDKESGSADGYDN--------FSDDYPDVAIG--ECVY--FITTGSEAG 216

  Fly   154 QLNDRPCHNHASSLFKYICEAP 175
            :.....|:...|    :|||.|
 Worm   217 KWKSGSCNPTMS----FICELP 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 33/152 (22%)
clec-32NP_001023952.1 CLECT 104..232 CDD:214480 33/150 (22%)
CLECT 249..356 CDD:214480
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.