DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and Lectin-galC1

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster


Alignment Length:186 Identity:107/186 - (57%)
Similarity:130/186 - (69%) Gaps:0/186 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKTLVQLFLVVAGFAPGFGYDKYTTHIQNGNPYNLTVDMTPFIKINESYYVFGQTKVNWYVAYE 65
            |||..|.|..::.....|:..:|::..:..||.:...|...||.|||:.||.||...:|||.|||
  Fly     1 MLKLTVLLITLLVIAKTGWTREKFSIQVNEGNTFGALVKAEPFTKINDGYYFFGTESLNWYEAYE 65

  Fly    66 NCRRLQSELVTFETAEEFDAIAAFLNARGDRSEHWTSGNDLGKTGTHYWFSNAQLVTIKRWAPKQ 130
            .||.|.||||||||.:||||:.|||.|.|.|..:|||||||.|||:|.||:|||.::..|||..|
  Fly    66 KCRELNSELVTFETDQEFDAVTAFLTANGSRLTYWTSGNDLAKTGSHRWFTNAQRISSLRWARNQ 130

  Fly   131 PDNAGGREHCIHLGYIYGYSTEFQLNDRPCHNHASSLFKYICEAPKQETVSIVVWK 186
            |||||.:||||||||||..|.:|:||||||....:||||||||||:.||:||||||
  Fly   131 PDNAGQKEHCIHLGYIYKDSRKFELNDRPCSQDPNSLFKYICEAPEMETISIVVWK 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 80/123 (65%)
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 79/121 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448791
Domainoid 1 1.000 56 1.000 Domainoid score I10954
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I5416
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26853
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0001931
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
88.010

Return to query results.
Submit another query.