DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and CG12111

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster


Alignment Length:199 Identity:66/199 - (33%)
Similarity:99/199 - (49%) Gaps:25/199 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKTLVQLFLVVAGFAPGFGY-------DKYTTHIQNGNPYNLTVDMTPFIKINES-YYVFGQTK 57
            |.:|...|.::.:...|...|       ..|.|.:.||.|..  :|.|||::|.:: ||:....|
  Fly     1 MYRTETLLLILTSVGIPSLAYLPDVNIFTNYRTEVYNGIPSE--IDTTPFVRIGDNYYYIEPMNK 63

  Fly    58 VNWYVAYENCRRLQSELVTFETAEEFDAIAAFLNARGDRSE--HWTSGNDLGKTGTHYWFSNAQL 120
            |||:.|...||.:.:.|.:.|...|.:|:..::.|:|.::.  .|.||||||..|..||.||.:.
  Fly    64 VNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFKNNDYFWISGNDLGTEGAFYWMSNGRP 128

  Fly   121 VTIKRW-APKQ-PDNAGGREHCIHLGYIYGYSTEFQLNDRPCHNHASSLFKYICEA--PKQETVS 181
            :|...| .||| |||.||.|:|:|:     ::|...:||..|    .....|:|||  ||....:
  Fly   129 MTYAPWNGPKQMPDNYGGNENCVHM-----FATREMINDANC----KIQMLYVCEATEPKTFKFT 184

  Fly   182 IVVW 185
            .:.|
  Fly   185 YIKW 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 45/128 (35%)
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 45/127 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448793
Domainoid 1 1.000 56 1.000 Domainoid score I10954
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 85 1.000 Inparanoid score I7429
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26853
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0001931
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.