DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment lectin-37Da and CD209

DIOPT Version :9

Sequence 1:	NP_001014489.1	Gene:	lectin-37Da / 3346222	FlyBaseID:	FBgn0053532	Length:	186	Species:	Drosophila melanogaster
Sequence 2:	NP_066978.1	Gene:	CD209 / 30835	HGNCID:	1641	Length:	404	Species:	Homo sapiens

Alignment Length:	131	Identity:	36/131 - (27%)
Similarity:	59/131 - (45%)	Gaps:	28/131 - (21%)

- Green bases have known domain annotations that are detailed below.

  Fly    51 YVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAIAAFLNARGDRSEH--WTSGNDLGKTGTHY 113
            |....::.||:.:...|:.:.::||..::|||.:    ||..:..||..  |...:||.:.||..
Human   268 YFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQN----FLQLQSSRSNRFTWMGLSDLNQEGTWQ 328

  Fly   114 WFSNAQLV-TIKR-WAPKQPDNAGGREHCIHLGYIYGYSTEFQ---LNDRPCHNHASSLFKY-IC 172
            |...:.|: :.|: |...:|:|. |.|.|          .||.   .||..|     :|.|: ||
Human   329 WVDGSPLLPSFKQYWNRGEPNNV-GEEDC----------AEFSGNGWNDDKC-----NLAKFWIC 377

  Fly   173 E 173
            :
Human   378 K 378

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
lectin-37Da	NP_001014489.1	CLECT	49..173	CDD:153057	35/129 (27%)
CD209	NP_066978.1	Endocytosis signal	14..15
		Endocytosis signal. /evidence=ECO:0000255	16..18
		Endocytosis signal. /evidence=ECO:0000255	31..34
		transmembrane domain	36..59
		PilO	38..>184	CDD:294757
		neck domain	60..249
		CLECT_DC-SIGN_like	256..379	CDD:153060	36/131 (27%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR22802
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	2.010