DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and Colec10

DIOPT Version :10

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001124013.1 Gene:Colec10 / 299928 RGDID:1307149 Length:277 Species:Rattus norvegicus


Alignment Length:144 Identity:31/144 - (21%)
Similarity:56/144 - (38%) Gaps:19/144 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 FIK--------INESYYVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAIAAFLNARGDRSEH 99
            |||        ..|.:|...|.:.|:..:..:| |::..::.....|..:.:.|...|:......
  Rat   144 FIKNVIAGIRETEEKFYYIVQEEKNYRESLTHC-RIRGGMLAMPKDEVVNTLIADYVAKSGFFRV 207

  Fly   100 WTSGNDLGKTGTHYWFSNAQLVTIKRWAPKQPDNAGGREHCIHLGYIYGYSTEFQLNDRPCHNHA 164
            :...|||.|.|.:.:..|..|.....|...:|.:..|.|.|:.:      .:..:.||..||   
  Rat   208 FIGVNDLEKEGQYVFTDNTPLQNYSNWKEGEPSDPYGHEDCVEM------LSSGRWNDTECH--- 263

  Fly   165 SSLFKYICEAPKQE 178
             ....::||..|::
  Rat   264 -LTMYFVCEFVKKK 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 24/123 (20%)
Colec10NP_001124013.1 gly_rich_SclB <46..>116 CDD:468478
CLECT_collectin_like 157..272 CDD:153061 26/125 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.