DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and Clec4a2

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001005880.1 Gene:Clec4a2 / 297584 RGDID:1359163 Length:235 Species:Rattus norvegicus


Alignment Length:210 Identity:46/210 - (21%)
Similarity:73/210 - (34%) Gaps:66/210 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVQLFLVVAGFAPGF--GYDKYTTHIQNG--------NPYNLTVDMTPFIKINE----------- 48
            :|.|.|:...|...|  .:.||:..::..        |..|.|.:    :.:.|           
  Rat    51 MVFLLLLTIAFLGSFIIYFQKYSQLLEEKKALTDKTLNDLNCTKN----VSLTEDKACSCCLKDW 111

  Fly    49 ----SYYVFGQT--KVNWYVAYENCRRLQSELVTFETAEEFDAIAAFLN-------ARGDRSEH- 99
                ||..|..|  |..|..:.|.|.|:.:.|:...:.:|.|.|...||       ...|.||: 
  Rat   112 KSFGSYCYFTSTDSKATWDESKEKCSRMGAHLLVIHSQDEQDFINTILNIGTDYFIGLSDHSENQ 176

  Fly   100 WTSGNDLGKTGTHYWFSNA---QLVTIKRWAPKQPDNAGGREHCIHLGYIYGYSTEFQLNDRPCH 161
            |            .|....   :.||.  |...:|:|.  .|.|:    :..:..::..||.|||
  Rat   177 W------------QWIDQTPYNESVTF--WHKGEPNNK--EEKCV----VINHRDKWGWNDIPCH 221

  Fly   162 NHASSLFKYICEAPK 176
            :.    .|.:|:..|
  Rat   222 DR----HKSVCQVKK 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 33/136 (24%)
Clec4a2NP_001005880.1 CLECT_DC-SIGN_like 107..229 CDD:153060 33/145 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.