DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and Clec4a1

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_955015.1 Gene:Clec4a1 / 269799 MGIID:3036291 Length:245 Species:Mus musculus


Alignment Length:132 Identity:32/132 - (24%)
Similarity:50/132 - (37%) Gaps:27/132 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAIAAFLNARGDRSEHWTSGNDLGKTGTHYWF 115
            |...:...:|..:.|.|....:.|:..::.||.|.|...||   .|:.::...:|....|...|.
Mouse   126 YFTSRDTASWSKSEEKCSLRGAHLLVIQSQEEQDFITNTLN---PRAAYYVGLSDPKGHGQWQWV 187

  Fly   116 SNA---QLVTIKRWAPKQPDNAGGREHCIHLGYI-----YGYSTEFQLNDRPCH-NHASSLFKYI 171
            ...   |..|  .|...:|  :|..|.|:.|.|.     :|:|.      .||. :|     :.|
Mouse   188 DQTPYDQNAT--SWHSDEP--SGNTEFCVVLSYHPNVKGWGWSV------APCDGDH-----RLI 237

  Fly   172 CE 173
            ||
Mouse   238 CE 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 30/130 (23%)
Clec4a1NP_955015.1 CLECT_DC-SIGN_like 114..240 CDD:153060 32/132 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.