DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and Cd207

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_659192.2 Gene:Cd207 / 246278 MGIID:2180021 Length:331 Species:Mus musculus


Alignment Length:136 Identity:40/136 - (29%)
Similarity:58/136 - (42%) Gaps:19/136 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SYYVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAIAAFLNARGDRSEHWTSGNDLGKTGTHY 113
            ::|.|.:|...||.|.:.|...::.|.:..:..|    ..||....|...||......|..|..|
Mouse   208 NFYYFSRTPKTWYSAEQFCISRKAHLTSVSSESE----QKFLYKAADGIPHWIGLTKAGSEGDWY 268

  Fly   114 W-----FSNAQLVTIKRWAPKQPDNAGGREHCIHLGYIYGYSTEFQLNDRPCHNHASSLFKYICE 173
            |     |:..|  :.:.|.|.:|:|||..|||.::    ..|.....||.||.|    .|.:||:
Mouse   269 WVDQTSFNKEQ--SRRFWIPGEPNNAGNNEHCANI----RVSALKCWNDGPCDN----TFLFICK 323

  Fly   174 APKQET 179
            .|..:|
Mouse   324 RPYVQT 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 37/128 (29%)
Cd207NP_659192.2 CLECT_DC-SIGN_like 201..324 CDD:153060 38/129 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 1 Normalized mean entropy S7305
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto92596
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.